Lemur catta (Ring-tailed lemur): 123643844 Help Entry 123643844         CDS       T08326                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04022   cGMP-PKG signaling pathway lcat04081   Hormone signaling lcat04270   Vascular smooth muscle contraction lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     123643844 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     123643844 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     123643844 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     123643844 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123643844 (NPPC) Cytokines and neuropeptides [BR:lcat04052]  Neuropeptides   Unclassified    123643844 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  123643844 NCBI-ProteinID:  XP_045415599 LinkDB All DBs Position 8:7256056..7260681 Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGAS GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGANKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccgaccc tccgaagccaagcccggggcgcctccaaaggtcccgcgaaccccgccgggagaggaggtg gctgagccccaggctgcgggcggcggtcaaaagaagggcgacaagactcccggggccagt ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgagcggcgtgggcccgccttctgcacgagcaccccaacgcgcgcaagtacaaagga gccaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system