KEGG   Lemur catta (Ring-tailed lemur): 123645738
Entry
123645738         CDS       T08326                                 
Symbol
NDUFA8
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
  KO
K03952  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
lcat  Lemur catta (Ring-tailed lemur)
Pathway
lcat00190  Oxidative phosphorylation
lcat01100  Metabolic pathways
lcat04714  Thermogenesis
lcat04723  Retrograde endocannabinoid signaling
lcat04932  Non-alcoholic fatty liver disease
lcat05010  Alzheimer disease
lcat05012  Parkinson disease
lcat05014  Amyotrophic lateral sclerosis
lcat05016  Huntington disease
lcat05020  Prion disease
lcat05022  Pathways of neurodegeneration - multiple diseases
lcat05208  Chemical carcinogenesis - reactive oxygen species
lcat05415  Diabetic cardiomyopathy
Module
lcat_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:lcat00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    123645738 (NDUFA8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    123645738 (NDUFA8)
  09159 Environmental adaptation
   04714 Thermogenesis
    123645738 (NDUFA8)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    123645738 (NDUFA8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123645738 (NDUFA8)
   05012 Parkinson disease
    123645738 (NDUFA8)
   05014 Amyotrophic lateral sclerosis
    123645738 (NDUFA8)
   05016 Huntington disease
    123645738 (NDUFA8)
   05020 Prion disease
    123645738 (NDUFA8)
   05022 Pathways of neurodegeneration - multiple diseases
    123645738 (NDUFA8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    123645738 (NDUFA8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    123645738 (NDUFA8)
SSDB
Motif
Pfam: CHCH CX9C Cmc1 COX6B
Other DBs
NCBI-GeneID: 123645738
NCBI-ProteinID: XP_045418124
LinkDB
Position
10:12193313..12206464
AA seq 172 aa
MPGIVELPTLEELKVQEVKVSSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLDEG
KLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGQQLFRHCRKQQAKFDECVLDKLGWVRP
DLGELSKVTKVKTDRPLPENPYHSRPRPEPNPEIKEDLKPARYGSRFFFWTK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccggggatagtggaactgcccactctagaggagctgaaagtgcaggaggtgaaagtc
agttctgctgtgcttaaagctgcagcccatcactatggagctcagtgtgacaagcccaac
aaggagttcatgctctgccgctgggaagagaaggatccgaggcggtgtttagacgaaggc
aagctggttaaccagtgtgctttggaattctttaggcagataaagcgtcactgtgcagag
ccttttacagaatattggacctgcatcgattattccggccagcagttatttcgtcactgt
cgcaaacagcaggcaaagtttgacgagtgtgtgctggacaaactgggctgggtgcggcct
gacttgggagaactgtcaaaggtcaccaaagtgaaaacagaccgacctttaccagagaat
ccctatcactcaagaccgagaccagagcccaaccctgagatcaaggaagatctgaagcct
gccagatatggcagccgcttttttttctggaccaagtga

DBGET integrated database retrieval system