Lemur catta (Ring-tailed lemur): 123646097 Help Entry 123646097         CDS       T08326                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04060   Cytokine-cytokine receptor interaction lcat04620   Toll-like receptor signaling pathway lcat04622   RIG-I-like receptor signaling pathway lcat04625   C-type lectin receptor signaling pathway lcat04630   JAK-STAT signaling pathway lcat04658   Th1 and Th2 cell differentiation lcat04936   Alcoholic liver disease lcat04940   Type I diabetes mellitus lcat05133   Pertussis lcat05134   Legionellosis lcat05140   Leishmaniasis lcat05142   Chagas disease lcat05143   African trypanosomiasis lcat05144   Malaria lcat05145   Toxoplasmosis lcat05146   Amoebiasis lcat05152   Tuberculosis lcat05162   Measles lcat05164   Influenza A lcat05168   Herpes simplex virus 1 infection lcat05171   Coronavirus disease - COVID-19 lcat05200   Pathways in cancer lcat05321   Inflammatory bowel disease lcat05330   Allograft rejection lcat05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123646097 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123646097 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123646097 (IL12A)    04622 RIG-I-like receptor signaling pathway     123646097 (IL12A)    04625 C-type lectin receptor signaling pathway     123646097 (IL12A)    04658 Th1 and Th2 cell differentiation     123646097 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123646097 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123646097 (IL12A)    05164 Influenza A     123646097 (IL12A)    05162 Measles     123646097 (IL12A)    05168 Herpes simplex virus 1 infection     123646097 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     123646097 (IL12A)    05134 Legionellosis     123646097 (IL12A)    05152 Tuberculosis     123646097 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     123646097 (IL12A)    05144 Malaria     123646097 (IL12A)    05145 Toxoplasmosis     123646097 (IL12A)    05140 Leishmaniasis     123646097 (IL12A)    05142 Chagas disease     123646097 (IL12A)    05143 African trypanosomiasis     123646097 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     123646097 (IL12A)    05330 Allograft rejection     123646097 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123646097 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     123646097 (IL12A)    04936 Alcoholic liver disease     123646097 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123646097 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123646097 (IL12A) Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Interleukins    123646097 (IL12A) Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Cytokines    123646097 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  123646097 NCBI-ProteinID:  XP_045418744 LinkDB All DBs Position 1:188888872..188894460 Genome browser AA seq 228 aa AA seqDB search MDGAGGQGHGRHRRPSQTTAQPALASPPGLLLVATLVLLDHLSLARNLPTTTPGPGTFQC LRHSQTLLRAVSTTLQKARQTLEFYPCTSEEIDHEDITKDKTSTVRACLPLELTKNESCL ASRETSFMMTQCLSSIYEDLKMYQLEFRAMNEKLLMDPKRQILLDQNMLALIDKLMQALN FNSETVPQKSSLEELDFYKTKIKLCILLHAFRIRVVTIDRVMSYLNSS NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggatggcgcaggtggccagggccatggcaggcacaggcggccaagccagaccacagct cagcctgccctcgcttcccctccaggcctcctccttgtggccaccctagtcctcctggac cacctcagcttggccaggaacctccccacgaccacaccaggcccaggaacgttccagtgc cttcgccattcccaaaccctgctgagagctgtcagcaccacgcttcagaaggctagacaa accctagaattttacccctgcacttctgaagagattgatcatgaagatatcacaaaagat aaaaccagcacagtgagggcctgtttaccactagaattaaccaagaatgagagttgcctg gcttccagagagacctcttttatgatgacccagtgccttagtagtatctatgaggacttg aagatgtaccagctggagttcagggccatgaatgaaaagcttttgatggatcctaagagg cagatccttctagatcaaaacatgctggcacttattgacaagctcatgcaggccctgaat ttcaacagtgagactgtgccacaaaaatcctcccttgaagaactggatttttataaaact aaaatcaagctctgcatacttcttcatgctttcagaatccgtgtggtgactatagataga gtgatgagctatctgaattcttcctaa

DBGET integrated database retrieval system