Lemur catta (Ring-tailed lemur): 123647499 Help Entry 123647499         CDS       T08326                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04072   Phospholipase D signaling pathway lcat04140   Autophagy - animal lcat04150   mTOR signaling pathway lcat04151   PI3K-Akt signaling pathway lcat04152   AMPK signaling pathway lcat04211   Longevity regulating pathway lcat04218   Cellular senescence lcat04714   Thermogenesis lcat04910   Insulin signaling pathway lcat04919   Thyroid hormone signaling pathway lcat05163   Human cytomegalovirus infection lcat05165   Human papillomavirus infection lcat05168   Herpes simplex virus 1 infection lcat05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     123647499 (RHEB)    04151 PI3K-Akt signaling pathway     123647499 (RHEB)    04152 AMPK signaling pathway     123647499 (RHEB)    04150 mTOR signaling pathway     123647499 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123647499 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     123647499 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     123647499 (RHEB)    04919 Thyroid hormone signaling pathway     123647499 (RHEB)   09149 Aging    04211 Longevity regulating pathway     123647499 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     123647499 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     123647499 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     123647499 (RHEB)    05163 Human cytomegalovirus infection     123647499 (RHEB)    05165 Human papillomavirus infection     123647499 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:lcat04031]     123647499 (RHEB) GTP-binding proteins [BR:lcat04031]  Small (monomeric) G-proteins   Ras Family    Rheb     123647499 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  123647499 NCBI-ProteinID:  XP_045420933 LinkDB All DBs Position 11:4851389..4903327 Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aacactttcacaaagttgatcacagtaaatggacaagaatatcatcttcagcttgtagac acagctgggcaagatgaatattccatctttcctcagacatactccatagatattaacggt tatatacttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggtcgggaataag aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaattgatggggcggcttcacaaggaaagtcttcg tgttcagtgatgtga

DBGET integrated database retrieval system