Lemur catta (Ring-tailed lemur): 123649674 Help Entry 123649674         CDS       T08326                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat03010   Ribosome lcat04120   Ubiquitin mediated proteolysis lcat04137   Mitophagy - animal lcat04140   Autophagy - animal lcat05012   Parkinson disease lcat05022   Pathways of neurodegeneration - multiple diseases lcat05167   Kaposi sarcoma-associated herpesvirus infection lcat05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:lcat00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     123649674   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123649674  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123649674    04137 Mitophagy - animal     123649674  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123649674    05167 Kaposi sarcoma-associated herpesvirus infection     123649674   09164 Neurodegenerative disease    05012 Parkinson disease     123649674    05022 Pathways of neurodegeneration - multiple diseases     123649674  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:lcat03011]     123649674    04121 Ubiquitin system [BR:lcat04121]     123649674 Ribosome [BR:lcat03011]  Ribosomal proteins   Eukaryotes    Large subunit     123649674   Archaea     123649674 Ubiquitin system [BR:lcat04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    123649674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 Ubiquitin_5 Dsc3_N TBK1_ULD Plexin_RBD UBL_UBAC1 HemeBinding_Shp Motif Other DBs NCBI-GeneID:  123649674 NCBI-ProteinID:  XP_045423803 LinkDB All DBs Position 14:19230476..19230848 Genome browser AA seq 77 aa AA seqDB search MQIFVKALTGKTITLEVEPSDTIQNVKAKIQDKEGTPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcaaatctttgtgaaggccctgactggcaagaccatcaccctcgaggtcgagcccagc gacaccattcagaatgtcaaggcaaagatccaagacaaggaaggcaccccccctgaccag cagaggctgatctttgccgggaagcagctggaagatggacgcaccctgtctgactacaac atccagaaagagtccaccctgcacttggtcctgcgcttgaggggaggtgtctaa

DBGET integrated database retrieval system