Lemur catta (Ring-tailed lemur): 123650127 Help Entry 123650127         CDS       T08326                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04024   cAMP signaling pathway lcat04062   Chemokine signaling pathway lcat04064   NF-kappa B signaling pathway lcat04210   Apoptosis lcat04380   Osteoclast differentiation lcat04620   Toll-like receptor signaling pathway lcat04621   NOD-like receptor signaling pathway lcat04622   RIG-I-like receptor signaling pathway lcat04623   Cytosolic DNA-sensing pathway lcat04625   C-type lectin receptor signaling pathway lcat04657   IL-17 signaling pathway lcat04658   Th1 and Th2 cell differentiation lcat04659   Th17 cell differentiation lcat04660   T cell receptor signaling pathway lcat04662   B cell receptor signaling pathway lcat04668   TNF signaling pathway lcat04722   Neurotrophin signaling pathway lcat04920   Adipocytokine signaling pathway lcat04926   Relaxin signaling pathway lcat04931   Insulin resistance lcat04936   Alcoholic liver disease lcat05132   Salmonella infection lcat05134   Legionellosis lcat05135   Yersinia infection lcat05140   Leishmaniasis lcat05142   Chagas disease lcat05145   Toxoplasmosis lcat05160   Hepatitis C lcat05161   Hepatitis B lcat05162   Measles lcat05163   Human cytomegalovirus infection lcat05164   Influenza A lcat05166   Human T-cell leukemia virus 1 infection lcat05167   Kaposi sarcoma-associated herpesvirus infection lcat05168   Herpes simplex virus 1 infection lcat05169   Epstein-Barr virus infection lcat05170   Human immunodeficiency virus 1 infection lcat05171   Coronavirus disease - COVID-19 lcat05200   Pathways in cancer lcat05203   Viral carcinogenesis lcat05208   Chemical carcinogenesis - reactive oxygen species lcat05215   Prostate cancer lcat05220   Chronic myeloid leukemia lcat05222   Small cell lung cancer lcat05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lcat05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     123650127 (NFKBIA)    04668 TNF signaling pathway     123650127 (NFKBIA)    04024 cAMP signaling pathway     123650127 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     123650127 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123650127 (NFKBIA)    04621 NOD-like receptor signaling pathway     123650127 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     123650127 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     123650127 (NFKBIA)    04625 C-type lectin receptor signaling pathway     123650127 (NFKBIA)    04660 T cell receptor signaling pathway     123650127 (NFKBIA)    04658 Th1 and Th2 cell differentiation     123650127 (NFKBIA)    04659 Th17 cell differentiation     123650127 (NFKBIA)    04657 IL-17 signaling pathway     123650127 (NFKBIA)    04662 B cell receptor signaling pathway     123650127 (NFKBIA)    04062 Chemokine signaling pathway     123650127 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     123650127 (NFKBIA)    04926 Relaxin signaling pathway     123650127 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     123650127 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     123650127 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123650127 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     123650127 (NFKBIA)    05203 Viral carcinogenesis     123650127 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123650127 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     123650127 (NFKBIA)    05215 Prostate cancer     123650127 (NFKBIA)    05222 Small cell lung cancer     123650127 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123650127 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     123650127 (NFKBIA)    05161 Hepatitis B     123650127 (NFKBIA)    05160 Hepatitis C     123650127 (NFKBIA)    05171 Coronavirus disease - COVID-19     123650127 (NFKBIA)    05164 Influenza A     123650127 (NFKBIA)    05162 Measles     123650127 (NFKBIA)    05168 Herpes simplex virus 1 infection     123650127 (NFKBIA)    05163 Human cytomegalovirus infection     123650127 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     123650127 (NFKBIA)    05169 Epstein-Barr virus infection     123650127 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     123650127 (NFKBIA)    05135 Yersinia infection     123650127 (NFKBIA)    05134 Legionellosis     123650127 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     123650127 (NFKBIA)    05140 Leishmaniasis     123650127 (NFKBIA)    05142 Chagas disease     123650127 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123650127 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123650127 (NFKBIA)    04931 Insulin resistance     123650127 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lcat03000]     123650127 (NFKBIA)    04131 Membrane trafficking [BR:lcat04131]     123650127 (NFKBIA) Transcription factors [BR:lcat03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     123650127 (NFKBIA) Membrane trafficking [BR:lcat04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     123650127 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  123650127 NCBI-ProteinID:  XP_045424579 LinkDB All DBs Position 1:55971882..55975618 Genome browser AA seq 314 aa AA seqDB search MFQPAEHAPQWAMEVPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagccggccgagcacgccccgcagtgggccatggaggtgccccgggatgggctg aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggatgag gaatacgagcagatggtgaaagagctccgggagatccgcctggagccgcaggaggtgccg cgcggcgccgagccctggaagcagcagctcactgaggacggagactcgttcctgcacttg gccatcatccatgaagaaaaggcactcaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccaaaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcatgtgagcaaggctgcctggccagcgtg ggagtcctcacgcagacctgcaccacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcatttagcctctatccatggctacctgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgcgcaggagccctgtaacggccggactgcc ctccacctcgcagtggacctgcagaatcctgacctggtgtcactcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctactccccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctggaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgatacggagtctgagttcacagaggatgagctg ccctacgatgactgtgtgtttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system