Lemur catta (Ring-tailed lemur): 123650820 Help Entry 123650820         CDS       T08326                                  Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat04060   Cytokine-cytokine receptor interaction lcat04061   Viral protein interaction with cytokine and cytokine receptor lcat04062   Chemokine signaling pathway lcat04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     123650820   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123650820    04061 Viral protein interaction with cytokine and cytokine receptor     123650820  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     123650820  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123650820    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123650820 Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Chemokines    123650820 Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Chemokines    123650820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123650820 NCBI-ProteinID:  XP_045425933 LinkDB All DBs Position 15:22935242..22937018 Genome browser AA seq 95 aa AA seqDB search MKVSAALLGLLLLATAFSPQGLAQPDALNTPTTCCFTFSSRKIPLQRLKSYYVTNSQCQQ KAVIFRTKLNKEVCADMKEKWVQSYAKHLEQKPTL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagcgctgctgggcctgctgctcctggccactgccttcagcccccag ggcctggctcagccggatgcactcaataccccgaccacttgctgcttcacgttcagcagt aggaagatccctttgcagaggctgaagagctattacgtcaccaacagccagtgtcaacag aaggctgtcatcttcagaaccaaactgaacaaggaggtctgtgccgacatgaaggagaag tgggtccagagttatgcgaaacacctggaacaaaaacccacgctctga

DBGET integrated database retrieval system