Lates calcarifer (barramundi perch): 108873638 Help Entry 108873638         CDS       T04895                                  Name (RefSeq) late histone H2A.L3   KO K11251   histone H2A Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf03082   ATP-dependent chromatin remodeling lcf04217   Necroptosis Brite KEGG Orthology (KO) [BR:lcf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108873638  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108873638  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lcf03036]     108873638   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108873638 Chromosome and associated proteins [BR:lcf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108873638 Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108873638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  108873638 NCBI-ProteinID:  XP_018517455 UniProt:  A0A4W6EQT0 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MSGRGKGAGKVKAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggaaaaggcgccggtaaagtcaaagctaaggccaagagccgctcctcc cgggccgggcttcagttcccggtgggtcgtgtccacaggctgctgaggaaggggaactac gcgcagcgggtcggtgccggagctccggtgtatctggcagcagtgctggagtacctgacc gctgagatcctggagctggcaggaaacgccgcccgcgacaacaagaagaccaggatcatt ccccgccacctgcagctggctgtccgcaacgacgaggagctcaacaagctgctgggcgga gtcaccatcgctcagggcggcgtactacccaacattcaggctgtcctgctgcccaagaag accgagaagcccgccaaaaagtaa

DBGET integrated database retrieval system