Lates calcarifer (barramundi perch): 108876084 Help Entry 108876084         CDS       T04895                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04517   IgSF CAM signaling lcf04814   Motor proteins lcf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108876084 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     108876084 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108876084 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lcf03037]     108876084 (dynll2a)    04812 Cytoskeleton proteins [BR:lcf04812]     108876084 (dynll2a) Cilium and associated proteins [BR:lcf03037]  Motile cilia and associated proteins   Dynein arm    108876084 (dynll2a) Cytoskeleton proteins [BR:lcf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      108876084 (dynll2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  108876084 NCBI-ProteinID:  XP_018520910 UniProt:  A0A4W6DMB4 LinkDB All DBs Position LG21:16461904..16465693 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaggaaagctgtgatcaagaacgcagacatgtccgaggacatgcagcaggac gccgtggactgtgccactcaggccatggagaagtacaacatagagaaggacattgcagct tacatcaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtcgggagg aacttcggcagctacgtcacccacgagacaaagcatttcatttacttctacttgggccaa gtggccatcttgctcttcaagtctggctga

DBGET integrated database retrieval system