Lates calcarifer (barramundi perch): 108881455 Help Entry 108881455         CDS       T04895                                  Symbol myl6 Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04270   Vascular smooth muscle contraction lcf04517   IgSF CAM signaling lcf04530   Tight junction lcf04814   Motor proteins Brite KEGG Orthology (KO) [BR:lcf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108881455 (myl6)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     108881455 (myl6)   09142 Cell motility    04814 Motor proteins     108881455 (myl6)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     108881455 (myl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lcf04812]     108881455 (myl6)    04147 Exosome [BR:lcf04147]     108881455 (myl6) Cytoskeleton proteins [BR:lcf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      108881455 (myl6) Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108881455 (myl6)   Exosomal proteins of bladder cancer cells    108881455 (myl6) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 CFAP251_C EF_EFCAB10_C AIF-1 EF-hand_8 Motif Other DBs NCBI-GeneID:  108881455 NCBI-ProteinID:  XP_018529002 UniProt:  A0A4W6EGU1 LinkDB All DBs Position LG12:complement(21497321..21501256) Genome browser AA seq 151 aa AA seqDB search MSDFSEDQIMEFKEAFLLFDRTGEGKITYSQCGDVMRALGQNPVNAEVLKVLGNPKLEEM NHKMLDFEQFLPMLQAIAKNKDQGSFEDIVEGLRVFDKEGNGTVMGAELRHVLTTLGEKM TEEEVETLLAGHEDANGCINYEELVRMVMSG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgacttctcagaggaccagatcatggaattcaaggaggccttccttctatttgac cggacgggcgaggggaagatcacctacagccagtgtggggatgttatgcgggcccttgga caaaaccctgtcaatgctgaggtcctcaaagtcctgggaaaccccaaattagaagagatg aaccacaagatgctggattttgaacagttcctgcccatgcttcaggccattgcaaagaac aaggaccagggctcctttgaggatattgtagagggcctgcgagtctttgacaaggaggga aatggtacagtgatgggagccgagctacgtcatgtcctcaccacactaggtgaaaaaatg acagaggaggaggtggagactcttttagcaggacacgaagacgccaatggctgcattaac tatgaagaacttgtccggatggtgatgagcggttga

DBGET integrated database retrieval system