Lates calcarifer (barramundi perch): 108881496 Help Entry 108881496         CDS       T04895                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04137   Mitophagy - animal lcf04140   Autophagy - animal lcf04144   Endocytosis lcf04145   Phagosome lcf04148   Efferocytosis lcf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcf00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108881496    04145 Phagosome     108881496    04140 Autophagy - animal     108881496    04137 Mitophagy - animal     108881496    04148 Efferocytosis     108881496  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108881496  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcf04131]     108881496   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108881496    04031 GTP-binding proteins [BR:lcf04031]     108881496 Membrane trafficking [BR:lcf04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108881496 Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108881496   Exosomal proteins of other body fluids (saliva and urine)    108881496   Exosomal proteins of colorectal cancer cells    108881496   Exosomal proteins of bladder cancer cells    108881496 GTP-binding proteins [BR:lcf04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108881496 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  108881496 NCBI-ProteinID:  XP_018529053 UniProt:  A0A4W6EIR2 LinkDB All DBs Position LG12:21974244..21983258 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSPESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcttgaaagtcatcatcctgggcgattccggtgttgga aagacctccctaatgaaccagtacgtgaacaagaagtttagtaaccagtacaaagctaca ataggagcagacttcctgaccaaggaggtgatggtggacgaccggctcgttacaatgcag atctgggacacggccggccaggagaggttccagtctttgggtgttgcattctaccgtggg gctgactgctgtgtactggtgtttgatgtgaccgcacccaataccttcaagacactcgac agctggagggatgagtttctgatccaggccagccctcgagatcctgagaactttcccttt gtggtgctcggcaacaagattgacttggagaatagacaggtaaccaccaaaagggctcag gcttggtgtcagagtaagaacaacatcccctactttgagaccagcgccaaagaagccata aatgtagaacaggcattccagacaattgcacgtaacgccctcaaacaggagacagaggtc gagttgtataatgaattcccagaaccaataaaactggataggaacgacagagctaaacct tcaccagaaagctgcagctgctaa

DBGET integrated database retrieval system