Lates calcarifer (barramundi perch): 108885638 Help Entry 108885638         CDS       T04895                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04137   Mitophagy - animal lcf04140   Autophagy - animal lcf04144   Endocytosis lcf04145   Phagosome lcf04148   Efferocytosis lcf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcf00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108885638 (rab7a)    04145 Phagosome     108885638 (rab7a)    04140 Autophagy - animal     108885638 (rab7a)    04137 Mitophagy - animal     108885638 (rab7a)    04148 Efferocytosis     108885638 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108885638 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcf04131]     108885638 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108885638 (rab7a)    04031 GTP-binding proteins [BR:lcf04031]     108885638 (rab7a) Membrane trafficking [BR:lcf04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108885638 (rab7a) Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108885638 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    108885638 (rab7a)   Exosomal proteins of colorectal cancer cells    108885638 (rab7a)   Exosomal proteins of bladder cancer cells    108885638 (rab7a) GTP-binding proteins [BR:lcf04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108885638 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  108885638 NCBI-ProteinID:  XP_018535586 UniProt:  A0A4W6FC99 LinkDB All DBs Position LG12:complement(15397713..15403052) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNGQQPRPAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtcaaggaagaaagtactactcaaagtcatcatccttggagactctggagttggg aagacctcactgatgaaccaatatgtgaataagaagttcagtaaccaatacaaagccaca ataggtgctgatttcctgacaaaagaagtcatggttgatgacagacttgtcacaatgcag atttgggatacagcgggtcaagagaggttccagtccttaggtgttgcattctaccgtgga gcagactgctgcgtcttggtgtttgacgtgacagcacccaacaccttcaagactctagac agctggagggacgagttcttgatccaggccagccctcgagaccctgagaatttccccttt gtggtgctgggcaacaaaatcgacttggagaacagacaggtaacaacaaagcgagcacag gcttggtgtcagagcaagaacaacatcccatatttcgaaaccagcgccaaggaagcaatc aatgtggagcaggcctttcagactattgcacgcaacgctctcaaacaggagaccgaagtg gagctgtacaacgagtttcctgagccaataaagctggacaagaatgggcaacagccgaga cctgcggagacctgcagctgctga

DBGET integrated database retrieval system