Lates calcarifer (barramundi perch): 108885938 Help Entry 108885938         CDS       T04895                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04382   Cornified envelope formation lcf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcf00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     108885938 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108885938 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108885938 (s100a10b) Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of microglial cells    108885938 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_1 SPARC_Ca_bdg DEK_C Motif Other DBs NCBI-GeneID:  108885938 NCBI-ProteinID:  XP_018535998 UniProt:  A0AAJ7PQK1 LinkDB All DBs Position LG15:complement(11763506..11765116) Genome browser AA seq 98 aa AA seqDB search MTDLEKSMESLITIFHHYASDDNDGKTLSKKELKKLIENELPTFLKAQKNPNVVDCIMKD LDQNKDDKLDFEEFIPLVVGLSMACEKCFTLHEKKGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgatttggagaaaagcatggagtccctgattacgattttccaccactatgccagt gatgacaatgatgggaagaccttgagcaagaaagaactgaaaaaacttattgagaacgag ttacccaccttcctgaaggcccagaaaaacccaaatgtcgtggactgcatcatgaaagat ttggaccaaaacaaagatgataagttggactttgaagaattcattcccctcgtagtcggc ctctcaatggcctgtgagaagtgtttcacgctccacgaaaagaagggcaagaagtga

DBGET integrated database retrieval system