Lates calcarifer (barramundi perch): 108887858 Help Entry 108887858         CDS       T04895                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04020   Calcium signaling pathway lcf04070   Phosphatidylinositol signaling system lcf04114   Oocyte meiosis lcf04218   Cellular senescence lcf04261   Adrenergic signaling in cardiomyocytes lcf04270   Vascular smooth muscle contraction lcf04371   Apelin signaling pathway lcf04625   C-type lectin receptor signaling pathway lcf04744   Phototransduction lcf04910   Insulin signaling pathway lcf04912   GnRH signaling pathway lcf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lcf00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     108887858    04020 Calcium signaling pathway     108887858    04070 Phosphatidylinositol signaling system     108887858  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108887858    04218 Cellular senescence     108887858  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108887858   09152 Endocrine system    04910 Insulin signaling pathway     108887858    04912 GnRH signaling pathway     108887858    04916 Melanogenesis     108887858   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108887858    04270 Vascular smooth muscle contraction     108887858   09157 Sensory system    04744 Phototransduction     108887858  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lcf01009]     108887858   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcf04131]     108887858    03036 Chromosome and associated proteins [BR:lcf03036]     108887858   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108887858 Protein phosphatases and associated proteins [BR:lcf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108887858 Membrane trafficking [BR:lcf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108887858 Chromosome and associated proteins [BR:lcf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108887858 Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108887858 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 CFAP251_C AIF-1 EF-hand_9 EF-hand_5 SAPC2_N EF-hand_EFHB_C EF-hand_11 MTIP_N p25-alpha GPHH WHD_DnaB EFhand_Ca_insen DUF5580_M Motif Other DBs NCBI-GeneID:  108887858 NCBI-ProteinID:  XP_018539004 UniProt:  A0A4W6F4J3 LinkDB All DBs Position LG2:complement(8679744..8685707) Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQINEYKECFSLYDKKQKGKIDVKDLITVMRCLGTSPTFGEIERHLQVHKIEK TGELDFHTFLTMMHRQIQQEDPKTEILEALRMTDKQKKGYIQASELRAKLTKLGEKLTDK EVDELFREANVKSNGTVNYEEFTQMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaaattcttcacaccagttcaaatcaatgagtacaaggagtgcttctctttgtat gacaagaagcaaaagggcaagattgatgtcaaagatctgatcacagttatgcgctgcctg ggcacaagccccacgttcggtgaaattgaaagacatctacaagttcacaaaattgaaaag acaggtgaactggacttccatacgttcctgaccatgatgcacagacagatacaacaggag gacccaaagacagagatcctggaggccctgaggatgacagacaagcagaagaaaggatac atccaggcgtctgagctccgagccaagctcaccaagttgggagagaagctcacggacaaa gaagtggatgaactcttcagagaggcaaacgtcaagtcaaatgggactgtcaactatgaa gagttcacccagatggtaacactgccacctgttgattactga

DBGET integrated database retrieval system