Lates calcarifer (barramundi perch): 108892980 Help Entry 108892980         CDS       T04895                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism lcf  Lates calcarifer (barramundi perch) Brite KEGG Orthology (KO) [BR:lcf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lcf03041]     108892980   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcf04052]     108892980 Spliceosome [BR:lcf03041]  Complex B   Other components    Complex B specific factors     108892980 Cytokines and neuropeptides [BR:lcf04052]  Neuropeptides   Unclassified    108892980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler DUF5343 OTU1_UBXL Motif Other DBs NCBI-GeneID:  108892980 NCBI-ProteinID:  XP_018546282 UniProt:  A0A4W6DJF1 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRHDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtctgcaacgatcgtctgggcaagaaagtccgggtcaaatgcaactct gaggataccattggagatctgaagaagctcattgctgcccagacaggaacacggcacgac aagattgtattaaagaaatggtataccatattcaaggatcatgtgtctctgggtgactat gaaatccatgatggcatgaacctggagctgtactaccagtag

DBGET integrated database retrieval system