Lates calcarifer (barramundi perch): 108893335 Help Entry 108893335         CDS       T04895                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf03082   ATP-dependent chromatin remodeling lcf04217   Necroptosis Brite KEGG Orthology (KO) [BR:lcf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108893335  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108893335  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lcf03036]     108893335   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108893335 Chromosome and associated proteins [BR:lcf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108893335 Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108893335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  108893335 NCBI-ProteinID:  XP_018546810 UniProt:  A0A4W6DGQ1 LinkDB All DBs Position LG20:4431743..4432632 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagagggaaaaccggaggcaaagcccgagcaaaggccaaatctcgctcttct cgtgccggactccagttcccggtgggtcgagtccacaggctactgcgcaaaggcaactac gcagagcgcgtcggcgccggggctccggtgtatctggcggccgtgctggagtatctgacc gctgagatcctggagctggcaggcaacgcggccagagacaacaagaagaccaggatcatc ccgcggcacctccagctggccgtgcgcaacgacgaggagctcaacaaactgctgggaggt gtgaccatcgctcagggaggagtgctgcccaacatccaggctgtcctcctccccaagaag acggagaaaccggccaagagcaagtaa

DBGET integrated database retrieval system