Lates calcarifer (barramundi perch): 108893384 Help Entry 108893384         CDS       T04895                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04010   MAPK signaling pathway lcf04068   FoxO signaling pathway lcf04081   Hormone signaling lcf04114   Oocyte meiosis lcf04140   Autophagy - animal lcf04150   mTOR signaling pathway lcf04810   Regulation of actin cytoskeleton lcf04910   Insulin signaling pathway lcf04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:lcf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108893384    04068 FoxO signaling pathway     108893384    04150 mTOR signaling pathway     108893384   09133 Signaling molecules and interaction    04081 Hormone signaling     108893384  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108893384   09143 Cell growth and death    04114 Oocyte meiosis     108893384   09142 Cell motility    04810 Regulation of actin cytoskeleton     108893384  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     108893384    04914 Progesterone-mediated oocyte maturation     108893384  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcf04052]     108893384 Cytokines and neuropeptides [BR:lcf04052]  Neuropeptides   Unclassified    108893384 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  108893384 NCBI-ProteinID:  XP_018546888 UniProt:  A0A4W6EKT4 LinkDB All DBs Position LG20:complement(17624961..17638889) Genome browser AA seq 115 aa AA seqDB search MATLWLHTASLLILLVMSCPGSQATATHYLCGAHLVDALYFICGERGFFYMPRSDNNPVQ QFVPPKEGRAVSVGGENGVTEFASQDHMEMMVKRSIVEQCCHRPCSIFELQNYCY NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcgacactgtggctccatactgcttctctgctgatcttactggtcatgtcgtgccca ggctctcaagccactgccacacattacctgtgtggcgctcacctcgtcgatgccctttat ttcatctgtggggaaagaggttttttctacatgccaaggagcgacaacaaccctgtgcag caattcgtccctccaaaggaaggcagagcagtatcagtgggcggtgagaatggggtcacc gagtttgcctcccaggaccatatggagatgatggtgaagcgaagcattgtggagcaatgc tgccacagaccctgcagcatctttgaactgcagaactactgctactga

DBGET integrated database retrieval system