Lates calcarifer (barramundi perch): 108893489 Help Entry 108893489         CDS       T04895                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04020   Calcium signaling pathway lcf04070   Phosphatidylinositol signaling system lcf04114   Oocyte meiosis lcf04218   Cellular senescence lcf04261   Adrenergic signaling in cardiomyocytes lcf04270   Vascular smooth muscle contraction lcf04371   Apelin signaling pathway lcf04625   C-type lectin receptor signaling pathway lcf04744   Phototransduction lcf04910   Insulin signaling pathway lcf04912   GnRH signaling pathway lcf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lcf00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     108893489    04020 Calcium signaling pathway     108893489    04070 Phosphatidylinositol signaling system     108893489  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108893489    04218 Cellular senescence     108893489  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108893489   09152 Endocrine system    04910 Insulin signaling pathway     108893489    04912 GnRH signaling pathway     108893489    04916 Melanogenesis     108893489   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108893489    04270 Vascular smooth muscle contraction     108893489   09157 Sensory system    04744 Phototransduction     108893489  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lcf01009]     108893489   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcf04131]     108893489    03036 Chromosome and associated proteins [BR:lcf03036]     108893489   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcf04147]     108893489 Protein phosphatases and associated proteins [BR:lcf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108893489 Membrane trafficking [BR:lcf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108893489 Chromosome and associated proteins [BR:lcf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108893489 Exosome [BR:lcf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108893489 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_9 EF-hand_8 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  108893489 NCBI-ProteinID:  XP_018547080 UniProt:  A0A4W6FDF1 LinkDB All DBs Position LG10:complement(2319061..2322631) Genome browser AA seq 151 aa AA seqDB search MVCVCVVTAEFKECFSLYDRQRKGRIEAQELIIVMRCLGSNPTPSEVQRHLLSHGIDRGG ELDFSTFLSIMHRQLQQEAPEEEILEAMRMADKEQKGFILASELRAKLTGLGEKLTDKEV DELLKEAGVGADGRVNCEQFAKAVTRSSAKR NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtgtttgtgtggttactgcagagtttaaggagtgtttctctctgtatgaccgc cagcggaaggggaggattgaagcccaggagttgatcatagtgatgcgatgcctcgggtca aaccccaccccctccgaggtccaacgacacctgctcagccacggcatagatcggggcgga gagctggacttctccaccttcctgagcatcatgcaccggcagctccagcaggaggcgccg gaggaggagatcctggaggccatgaggatggccgacaaggagcagaagggcttcatcctg gcctctgagctgagagccaagctgaccggactgggagagaaactgactgacaaagaggtg gacgagctgctgaaggaggcgggcgttggggctgacggtcgggtcaactgcgagcagttt gctaaagcagtgacgcgctcgtctgcaaagcgctga

DBGET integrated database retrieval system