Lates calcarifer (barramundi perch): 108899246 Help Entry 108899246         CDS       T04895                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:lcf00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     108899246 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lcf03036]     108899246 (cenps)    03400 DNA repair and recombination proteins [BR:lcf03400]     108899246 (cenps) Chromosome and associated proteins [BR:lcf03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      108899246 (cenps) DNA repair and recombination proteins [BR:lcf03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      108899246 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Histone Serine_rich DUF7229 Bromo_TP TAF Motif Other DBs NCBI-GeneID:  108899246 NCBI-ProteinID:  XP_018555104 UniProt:  A0AAJ7QFW6 LinkDB All DBs Position LG8:9812211..9815351 Genome browser AA seq 124 aa AA seqDB search MKMSVDKDETLQRLKAAVHYTVGRLCQKTGEDHRREFSRQVIAAIAETTFRQCDIFAKDL EAFARHAKRSTVTTDDVKLVARRSTALSIYIQNKSEELNQEQKDLKKKNTGKRKSRETEE ESRE NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgaaaatgtcagttgacaaagacgaaacgcttcagaggttaaaggcagctgtacactac actgtgggtcgtctgtgtcagaagacaggagaggaccaccggagagagttcagtcgacag gtcatagcagcaatagccgagacaacattcagacaatgtgatatatttgctaaagacctg gaggccttcgcaaggcatgccaaaagaagcaccgtgactacagatgatgtgaagcttgta gcccgtcgtagtactgcactgtccatctacatacaaaataaaagcgaagaactgaaccag gagcagaaggatttgaaaaagaagaatactgggaagaggaagagcagagaaactgaggag gaaagcagagaataa

DBGET integrated database retrieval system