Lates calcarifer (barramundi perch): 108903054 Help Entry 108903054         CDS       T04895                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf04621   NOD-like receptor signaling pathway lcf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcf00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108903054  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108903054  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lcf03110]     108903054 Chaperones and folding catalysts [BR:lcf03110]  Protein folding catalysts   Protein disulfide isomerase    108903054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin OST3_OST6 AhpC-TSA Thioredoxin_2 Thioredoxin_9 Thioredoxin_7 DIM1 Thioredoxin_8 Redoxin Motif Other DBs NCBI-GeneID:  108903054 NCBI-ProteinID:  XP_018560648 UniProt:  A0A4W6BS07 LinkDB All DBs Position LG14:7308644..7311418 Genome browser AA seq 107 aa AA seqDB search MVRMVESVAEFDDILKEAGDKLVVVDFTATWCGPCKYIAPVFEALSKDPENKNVIFLKVD VDEVQDLCTRCEIRSMPTFQFYKKGQKLEAFSGADPDKLKSKVAALR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggttcgcatggtggaaagtgtggcggagtttgatgacatcctgaaggaggccggagac aagctggtggtggtggacttcacagccacatggtgtggcccctgtaaatacatcgcccca gtatttgaagcgctgtcaaaagatcctgagaacaagaacgtgatcttcctgaaggtggat gtggacgaggttcaggatctgtgtacacgctgcgagattaggagcatgcccacattccaa ttctacaagaaaggacagaagttggaggcattctccggtgctgatccagacaaactgaaa agcaaagtggcagctctgagatga

DBGET integrated database retrieval system