Novilysobacter ciconiae: INQ41_00575 Help Entry INQ41_00575       CDS       T08092                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lcic  Novilysobacter ciconiae Pathway lcic01100   Metabolic pathways lcic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lcic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     INQ41_00575    00074 Mycolic acid biosynthesis     INQ41_00575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     INQ41_00575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN Motif Other DBs NCBI-ProteinID:  QOW19628 UniProt:  A0A7S6UG31 LinkDB All DBs Position 124656..124925 Genome browser AA seq 89 aa AA seqDB search MSAQSPAEAALAQLLVDSLNLEDVVPAEIDPEAPLFGEGLGLDSIDALELALAISKEHGF QLRSDNEDNRRVFASLRSLSAHVEQNKAS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccgcacaaagccccgccgaggccgccctggcccaactgctggtcgacagtctcaac ctggaagacgtggtgcccgccgagatcgatcccgaagcgcccctgttcggcgagggcctg ggcctggattcgatcgatgcgctcgaactggccctggcgatcagcaaggagcacggcttc cagctgcgctccgacaacgaggacaaccgccgggtgttcgcgtccctgcgctcgctgtcg gcgcacgtcgagcagaacaaggccagctga

DBGET integrated database retrieval system