Lichenicola cladoniae: HN018_10645 Help Entry HN018_10645       CDS       T07054                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism lck  Lichenicola cladoniae Pathway lck02024   Quorum sensing lck03018   RNA degradation Brite KEGG Orthology (KO) [BR:lck00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HN018_10645 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HN018_10645 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lck03019]     HN018_10645 (hfq)    03036 Chromosome and associated proteins [BR:lck03036]     HN018_10645 (hfq) Messenger RNA biogenesis [BR:lck03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HN018_10645 (hfq) Chromosome and associated proteins [BR:lck03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HN018_10645 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QKE90430 UniProt:  A0A6M8HQ70 LinkDB All DBs Position 2293224..2293532 Genome browser AA seq 102 aa AA seqDB search MAKDNSQNVQDVFLNHVRRSKTPVTIFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKH AISTVMPAAPIALFDQNKVEGGVAVPAGAETEQEVALMKSIV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggacaactcgcagaacgtgcaggacgtatttctcaatcacgtccgtcgttcc aagactccggtgacgattttcctggtcaacggcgtcaagctccaggggatcatcacctgg ttcgataacttctcggtcctgttgcgtcgggatgggcacacccagctcgtctacaagcac gccatcagcaccgtgatgccggcggcgccgatcgccttgttcgatcagaacaaggtcgag ggtggcgttgccgttcccgccggcgccgagaccgagcaggaagtggcgctgatgaaaagc atcgtctga

DBGET integrated database retrieval system