Lichenicola cladoniae: HN018_16500 Help Entry HN018_16500       CDS       T07054                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lck  Lichenicola cladoniae Pathway lck00998   Biosynthesis of various antibiotics lck01100   Metabolic pathways lck01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lck00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HN018_16500    00074 Mycolic acid biosynthesis     HN018_16500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HN018_16500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QKE92730 UniProt:  A0A6M8HWN0 LinkDB All DBs Position complement(3644597..3644812) Genome browser AA seq 71 aa AA seqDB search MTEVFHEVFGDDTIRLTPTTSAEQVAGWDSIKMVTIIISVEQQFGIKLRSREVDQLKNVG DLATLVQAKAA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt ctgaccgaagtgttccacgaggtgttcggcgacgacaccatcaggctgaccccgaccacg tcggccgagcaggtggccggctgggattcgatcaagatggtgaccatcatcatcagcgtc gagcagcagttcggcatcaagctccgctcgcgcgaggtcgaccagctcaagaatgtcggc gacctggccacgctggtccaagccaaggccgcctga

DBGET integrated database retrieval system