Lichenicola cladoniae: HN018_24925 Help Entry HN018_24925       CDS       T07054                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lck  Lichenicola cladoniae Brite KEGG Orthology (KO) [BR:lck00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lck03032]     HN018_24925    03036 Chromosome and associated proteins [BR:lck03036]     HN018_24925    03400 DNA repair and recombination proteins [BR:lck03400]     HN018_24925 DNA replication proteins [BR:lck03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HN018_24925 Chromosome and associated proteins [BR:lck03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HN018_24925 DNA repair and recombination proteins [BR:lck03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HN018_24925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QKE93430 UniProt:  A0A6M8HYK1 LinkDB All DBs Position unnamed2:complement(158745..159014) Genome browser AA seq 89 aa AA seqDB search MSKAFIAATLQDSTGCTGVAANLAAAELIAAIVSEMKKDGGFTLPSFGTFTVRKTKARKA LNPRTGEPVKVKAGKTVRFKASPNLKKAV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaaggccttcattgcagcgacattgcaggattcgaccggctgcaccggcgttgcc gccaatctagcggcggccgagctgatcgcggccattgtctcagaaatgaagaaggacggc ggcttcaccctgccctcgttcggcaccttcaccgtcaggaagaccaaggcgcgcaaggcg ctgaacccgcgcaccggcgagccggtcaaggtcaaggccggcaagaccgtccgcttcaag gccagcccgaacctcaagaaggccgtctag

DBGET integrated database retrieval system