Latimeria chalumnae (coelacanth): 102347712 Help Entry 102347712         CDS       T02913                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04621   NOD-like receptor signaling pathway lcm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcm00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102347712  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102347712  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lcm03110]     102347712 Chaperones and folding catalysts [BR:lcm03110]  Protein folding catalysts   Protein disulfide isomerase    102347712 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 DIM1 Thioredoxin_9 OST3_OST6 AhpC-TSA Thioredoxin_7 Redoxin HyaE TraF TXD17-like_Trx Phosducin Motif Other DBs NCBI-GeneID:  102347712 NCBI-ProteinID:  XP_005996498 Ensembl:  ENSLACG00000002049 UniProt:  H2ZY23 LinkDB All DBs Position Un AA seq 105 aa AA seqDB search MVRRIDNMEQFDAALKEAGSKLVVVDFFAEWCGPCKMIAPKIEALSKTYTNVVFLKVDVD EAEDVAQHYEITAMPTFIFFKDGKKLEVFCGANADKLVQKIEELK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggttagaagaatcgataatatggaacagtttgatgccgccttgaaggaagcaggctcc aagcttgtggtggttgatttttttgctgaatggtgtggtccttgtaaaatgattgcgcca aaaattgaggcactttcgaaaacctacacaaatgttgtgtttcttaaagttgatgttgac gaggctgaggatgtagcacaacattatgaaatcacagccatgccaacattcattttcttc aaggatggaaagaagcttgaggtattctgtggtgccaacgctgataagctagtgcagaag attgaggaactgaagtag

DBGET integrated database retrieval system