Latimeria chalumnae (coelacanth): 102348278 Help Entry 102348278         CDS       T02913                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04010   MAPK signaling pathway lcm04068   FoxO signaling pathway lcm04081   Hormone signaling lcm04114   Oocyte meiosis lcm04140   Autophagy - animal lcm04150   mTOR signaling pathway lcm04810   Regulation of actin cytoskeleton lcm04910   Insulin signaling pathway lcm04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:lcm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102348278 (INS)    04068 FoxO signaling pathway     102348278 (INS)    04150 mTOR signaling pathway     102348278 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     102348278 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102348278 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     102348278 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102348278 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102348278 (INS)    04914 Progesterone-mediated oocyte maturation     102348278 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcm04052]     102348278 (INS) Cytokines and neuropeptides [BR:lcm04052]  Neuropeptides   Unclassified    102348278 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  102348278 NCBI-ProteinID:  XP_006008147 LinkDB All DBs Position Un AA seq 107 aa AA seqDB search MALWVRVLPLFLLIALSAPSTTQAIANQHLCGSHLVEALYLVCGEKGFFYSPRGRREIEQ SLIKSGLENEVEELPFQQQGTMKEKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggccctctgggttcgagtcctccctctgtttctactgatcgccctctcagctcccagc accacgcaagctattgctaaccagcatctatgtggctcccacctggtggaggctctctac ctggtctgtggggaaaagggcttcttctactcaccccgaggcagaagagagatcgaacag tcactgattaagagcggcctggagaacgaggttgaggagctccccttccagcaacaaggg accatgaaggaaaagaggggcatagtagaacagtgctgtcacaacacctgctccctgtac cagctagaaaactactgcaactga

DBGET integrated database retrieval system