Latimeria chalumnae (coelacanth): 102348304 Help Entry 102348304         CDS       T02913                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04140   Autophagy - animal lcm04144   Endocytosis lcm04530   Tight junction Brite KEGG Orthology (KO) [BR:lcm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102348304 (RAB8A)    04140 Autophagy - animal     102348304 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102348304 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcm04131]     102348304 (RAB8A)    03036 Chromosome and associated proteins [BR:lcm03036]     102348304 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcm04147]     102348304 (RAB8A)    04031 GTP-binding proteins [BR:lcm04031]     102348304 (RAB8A) Membrane trafficking [BR:lcm04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102348304 (RAB8A)  Autophagy   Other autophagy associated proteins     102348304 (RAB8A) Chromosome and associated proteins [BR:lcm03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102348304 (RAB8A) Exosome [BR:lcm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102348304 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102348304 (RAB8A)   Exosomal proteins of colorectal cancer cells    102348304 (RAB8A) GTP-binding proteins [BR:lcm04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102348304 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 DUF6974 AAA_7 Tor_FN3_2nd Motif Other DBs NCBI-GeneID:  102348304 NCBI-ProteinID:  XP_005989945 Ensembl:  ENSLACG00000017882 UniProt:  H3BEN1 LinkDB All DBs Position Un AA seq 206 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILG NKCDVNEKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSHQGVKISEQQKKSSFFRCGLL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacgtacgattatctgttcaagctgctgctgatcggggactcgggggtcggc aagacctgcgtcctcttccgcttctccgaggacgccttcaattccaccttcatctccacc atcggtatcgactttaaaattagaacaatagaactagatggaaagaaaattaaactacag atatgggacacagctggtcaggaaaggtttcgaacaatcacaacggcgtattacagaggt gcaatgggtatcatgctggtatacgacatcaccaatgaaaaatcatttgaaaacatcaag aactggatacgaaatatagaagagcatgcctctgccgacgtagaaaagatgatccttggg aacaagtgtgatgtaaatgaaaaacgacaagtgtctaaagagcgaggagagaagctagcc ctggactatgggatcaaattcatggagaccagtgcgaaagcaaatataaatgtggagaac gcattttttactcttgccagagacatcaaagcaaaaatggacaaaaaattagaagggaac agtccgcaaggcagtcaccagggggttaaaatctctgaacagcagaagaagagcagcttt ttccgatgtggcctcctttga

DBGET integrated database retrieval system