Latimeria chalumnae (coelacanth): 102349913 Help Entry 102349913         CDS       T02913                                  Symbol DCTN5 Name (RefSeq) dynactin subunit 5   KO K10427   dynactin 5 Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04814   Motor proteins lcm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcm00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102349913 (DCTN5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102349913 (DCTN5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lcm03036]     102349913 (DCTN5)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lcm04812]     102349913 (DCTN5) Chromosome and associated proteins [BR:lcm03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      102349913 (DCTN5) Cytoskeleton proteins [BR:lcm04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      102349913 (DCTN5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DCTN5 Hexapep LbH_EIF2B Fucose_pyrophosphorylase Motif Other DBs NCBI-GeneID:  102349913 NCBI-ProteinID:  XP_005998540 LinkDB All DBs Position Un AA seq 117 aa AA seqDB search MELCEMLYNKAEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH CVIKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHIGKNCVIV NT seq 352 nt NT seq  +upstreamnt  +downstreamnt atggagctgtgtgagatgttgtataacaaagcagaatatatagaaacggcttctggaaat aaggttagcagacagtctgttctgtgtggaagtcagaatattgttctaaatggcaaaaca attgttatgaatgactgcataattcgcggtgatctggccaatgtgagggttggacgccac tgtgttattaagagccgaagtgtaataagaccaccattcaaaaaattcagcaaaggagtt gccttctttccccttcacattggagaccatgtattcattgaagaggactgtgtcgtgaat gctgcacagattgggtcttatgttcatataggaaagaactgtgtgattgtaa

DBGET integrated database retrieval system