Latimeria chalumnae (coelacanth): 102357665 Help Entry 102357665         CDS       T02913                                  Symbol DYNLL1 Name (RefSeq) dynein light chain LC8-type 1   KO K10418   dynein light chain LC8-type Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04814   Motor proteins lcm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcm00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102357665 (DYNLL1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102357665 (DYNLL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lcm03037]     102357665 (DYNLL1)    04812 Cytoskeleton proteins [BR:lcm04812]     102357665 (DYNLL1) Cilium and associated proteins [BR:lcm03037]  Motile cilia and associated proteins   Dynein arm    102357665 (DYNLL1) Cytoskeleton proteins [BR:lcm04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102357665 (DYNLL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Imm48 Motif Other DBs NCBI-GeneID:  102357665 NCBI-ProteinID:  XP_005987216 Ensembl:  ENSLACG00000018220 UniProt:  H3BFR5 LinkDB All DBs Position Un AA seq 89 aa AA seqDB search MSERKAVIKNADMPEDMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgagagaaaggctgttattaagaatgctgatatgcctgaggatatgcagcaggat gctgtggattgtgctacccaggccctggagaaatataatattgaaaaagatatagctgct ttcatcaagaaggagtttgataagaagtacaaccccacttggcactgtattgtgggcagg aactttggcagttatgttactcatgagaccaaacacttcatttatttctacctgggtcaa gtagccatccttctctttaaatccggttaa

DBGET integrated database retrieval system