Latimeria chalumnae (coelacanth): 102357980 Help Entry 102357980         CDS       T02913                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04814   Motor proteins lcm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcm00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102357980 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102357980 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lcm03037]     102357980 (DYNLT3)    04812 Cytoskeleton proteins [BR:lcm04812]     102357980 (DYNLT3) Cilium and associated proteins [BR:lcm03037]  Motile cilia and associated proteins   Dynein arm    102357980 (DYNLT3) Cytoskeleton proteins [BR:lcm04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102357980 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  102357980 NCBI-ProteinID:  XP_005999557 Ensembl:  ENSLACG00000002963 UniProt:  H3A0Z2 LinkDB All DBs Position Un AA seq 115 aa AA seqDB search MEEYHHNEEFLFNAEEASDMVKECIEGVIGRVDYNHNQVNQWTAGIVEQSLTQLVKLGKP LKYIVNCAVMQKSGAGLHTANSCFWDTTTDGSCTVRWENRTMYCIVSVFAVAIAL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtatcatcacaacgaggagtttctcttcaatgcagaagaagccagcgatatg gttaaggagtgcattgaaggtgttataggcagagtagattacaaccacaaccaagtcaac cagtggactgccggtattgtggagcagtcattaacccagctggttaagctgggaaaacca ctaaagtatattgtgaactgtgcagttatgcagaaaagtggagctggccttcacactgct aattcatgcttttgggacaccacgactgacggaagctgcacagtaagatgggagaacagg actatgtactgtattgttagtgtttttgctgttgccatcgccctgtga

DBGET integrated database retrieval system