Latimeria chalumnae (coelacanth): 102359885 Help Entry 102359885         CDS       T02913                                  Symbol GNG7 Name (RefSeq) G protein subunit gamma 7   KO K04543   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04081   Hormone signaling lcm04082   Neuroactive ligand signaling lcm04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:lcm00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102359885 (GNG7)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102359885 (GNG7)    04081 Hormone signaling     102359885 (GNG7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcm04147]     102359885 (GNG7)    04031 GTP-binding proteins [BR:lcm04031]     102359885 (GNG7) Exosome [BR:lcm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102359885 (GNG7)   Exosomal proteins of other body fluids (saliva and urine)    102359885 (GNG7) GTP-binding proteins [BR:lcm04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102359885 (GNG7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma FtsX_ECD Motif Other DBs NCBI-GeneID:  102359885 NCBI-ProteinID:  XP_006002367 Ensembl:  ENSLACG00000006783 UniProt:  H3ADD3 LinkDB All DBs Position Un AA seq 68 aa AA seqDB search MSTTNNIAQARKLVEQLRIEAGIERIKVSKAAADLMNYCEQHARNDPLLVGVPASENPFK DKKPCIIL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtcgacaactaacaacatagcacaggccaggaagctggtggagcagctccgtattgag gctggcattgagaggatcaaggtgtctaaagcagccgcagacctcatgaattactgtgag cagcatgccagaaatgatcctctgctcgttggtgttcctgcctccgagaatccattcaag gacaaaaaaccttgtatcatcctatag

DBGET integrated database retrieval system