Latimeria chalumnae (coelacanth): 102360103 Help Entry 102360103         CDS       T02913                                  Name (RefSeq) claudin-19-like   KO K06087   claudin Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm03272   Virion - Hepatitis viruses lcm04382   Cornified envelope formation lcm04514   Cell adhesion molecules lcm04530   Tight junction Brite KEGG Orthology (KO) [BR:lcm00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102360103  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102360103  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102360103  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102360103  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lcm03037]     102360103    04147 Exosome [BR:lcm04147]     102360103    04515 Cell adhesion molecules [BR:lcm04515]     102360103 Cilium and associated proteins [BR:lcm03037]  Other cilia and associated proteins   Stereociliary proteins    102360103 Exosome [BR:lcm04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102360103   Exosomal proteins of colorectal cancer cells    102360103 Cell adhesion molecules [BR:lcm04515]  Immunoglobulin superfamily   L1 family    102360103 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  102360103 NCBI-ProteinID:  XP_006012744 Ensembl:  ENSLACG00000022476 LinkDB All DBs Position Un AA seq 144 aa AA seqDB search MISSLILGLFATVLGLLGLKCTKIGSSNKIMKGKIALTGGVLFIIGGLSSMIAVSWYAQQ ITSEFFNPMYGGTKFEFGDALYLGWAGSALCMLGGSFLCCSCKRDEVPKRSVYQYSAAQS ASGGRIYSKGARSEDNTLSSKAYV NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgatctcctccctcatcctgggcctctttgccactgtgctgggtctcctggggctcaaa tgtaccaagataggctccagcaacaagatcatgaaggggaaaattgccttgacaggaggg gtgctcttcatcattggaggcctctcttccatgattgcagtctcttggtatgcccagcaa attacctctgaatttttcaacccaatgtatggaggaacaaaatttgaatttggtgatgct ctgtatctgggctgggctggatctgccctttgtatgcttggggggagcttcctctgctgt tcctgcaaaagagatgaagttcccaaaaggagtgtttaccagtactcggctgcacagtct gcttctggtgggcgcatttacagcaagggcgcccggagtgaagacaacaccttgagctca aaggcctacgtctga

DBGET integrated database retrieval system