Latimeria chalumnae (coelacanth): 102363815 Help Entry 102363815         CDS       T02913                                  Symbol RAB11B Name (RefSeq) ras-related protein Rab-11B   KO K07905   Ras-related protein Rab-11B Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04144   Endocytosis Brite KEGG Orthology (KO) [BR:lcm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102363815 (RAB11B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lcm04131]     102363815 (RAB11B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lcm04147]     102363815 (RAB11B)    04031 GTP-binding proteins [BR:lcm04031]     102363815 (RAB11B) Membrane trafficking [BR:lcm04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     102363815 (RAB11B) Exosome [BR:lcm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102363815 (RAB11B)   Exosomal proteins of other body fluids (saliva and urine)    102363815 (RAB11B)   Exosomal proteins of colorectal cancer cells    102363815 (RAB11B) GTP-binding proteins [BR:lcm04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     102363815 (RAB11B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_22 PduV-EutP AAA_16 AAA_14 ABC_tran Gtr1_RagA FeoB_N NTPase_1 TniB DUF3289 AAA_24 AAA_28 SRPRB AAA_21 MCM AAA_5 AAA_7 AAA_29 Motif Other DBs NCBI-GeneID:  102363815 NCBI-ProteinID:  XP_005989918 Ensembl:  ENSLACG00000016974 UniProt:  H3BBM7 LinkDB All DBs Position Un AA seq 172 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTGE NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgggaaccagagacgacgagtacgactatctgttcaaagtcgtattaattggggactcg ggcgttggaaagagtaacctcctgtcacgtttcacacgtaatgagtttaacctggagagt aagagcaccatcggagtcgagtttgccaccaggagcatccaggtggacgggaagacaata aaagctcaaatctgggacacagccggacaggagcgctatagggccatcacctctgcgtac taccggggtgcagtaggggccctgttagtgtacgacattgccaaacacctgacctacgag aacgtggagcgctggctgaaggagctgcgtgaccatgcggacaataacattgtgattatg cttgtgggaaacaagagtgaccttcgacatctgagagccgtgcccacggacgaggcgcgg gcatttgcagaaaagaataacttatcgtttattgaaacgtctgcgttagattcaactaat gtagaagaggcatttaaaaatattctcacaggtgagtga

DBGET integrated database retrieval system