Latimeria chalumnae (coelacanth): 106706701 Help Entry 106706701         CDS       T02913                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04060   Cytokine-cytokine receptor interaction lcm04218   Cellular senescence lcm04620   Toll-like receptor signaling pathway lcm04621   NOD-like receptor signaling pathway lcm04622   RIG-I-like receptor signaling pathway lcm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lcm00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106706701  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     106706701  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106706701    04621 NOD-like receptor signaling pathway     106706701    04622 RIG-I-like receptor signaling pathway     106706701  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106706701  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcm04052]     106706701    00536 Glycosaminoglycan binding proteins [BR:lcm00536]     106706701 Cytokines and neuropeptides [BR:lcm04052]  Cytokines   Chemokines    106706701 Glycosaminoglycan binding proteins [BR:lcm00536]  Heparan sulfate / Heparin   Chemokines    106706701 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106706701 NCBI-ProteinID:  XP_014353483 LinkDB All DBs Position Un AA seq 98 aa AA seqDB search MWGKNANLAFYAMAVLGCILITEGFHLHGMGEMVLQCQCVAVTSIPIHPRRIQQIQVNQK TPFCNKVEVIATLRRNQQQVCLDPKAKWVNHIFSTIQW NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtgggggaagaacgctaacctggcattttacgctatggctgtcttaggctgcattctc ataacagaaggatttcatttgcatggaatgggagaaatggtactgcaatgccagtgtgtt gccgtcacttcaatacccattcatcctcgtagaatccagcagatacaagtcaaccaaaag accccattctgtaacaaagtggaggttattgcaactctgaggaggaatcagcaacaggta tgcttggatcctaaagctaagtgggtgaatcacattttcagcaccatccaatggtaa

DBGET integrated database retrieval system