Lysobacter capsici: LC55x_2725 Help Entry LC55x_2725        CDS       T04162                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism lcp  Lysobacter capsici Pathway lcp00261   Monobactam biosynthesis lcp01100   Metabolic pathways lcp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lcp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LC55x_2725  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:lcp01008]     LC55x_2725 Polyketide biosynthesis proteins [BR:lcp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LC55x_2725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ALN85990 LinkDB All DBs Position 3106188..3106406 Genome browser AA seq 72 aa AA seqDB search MTNPFEDTNGSFLVLVNDENQHSLWPEFAEVPAGWKRVFGPDQRQSCLDYVEQHWVDMRP ASLAALDDARAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaccaatcctttcgaagacaccaacggcagcttcctcgtcctggtcaacgacgagaac cagcattcgctgtggcccgagttcgccgaagtcccggccggctggaagcgcgtgttcggc ccggaccagcgtcagtcctgcctggattatgtcgagcagcactgggtcgacatgcgcccg gccagcctcgcggccttggacgacgcccgcgccgcctga

DBGET integrated database retrieval system