KEGG   Lactobacillus crispatus: LCRIS_00717
Entry
LCRIS_00717       CDS       T01222                                 
Symbol
potA
Name
(GenBank) Spermidine/putrescine ABC transporter, ATP-binding protein (PotA)
  KO
K11072  spermidine/putrescine transport system ATP-binding protein [EC:7.6.2.11]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LCRIS_00717 (potA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcr02000]
    LCRIS_00717 (potA)
Enzymes [BR:lcr01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.11  ABC-type polyamine transporter
     LCRIS_00717 (potA)
Transporters [BR:lcr02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter
    LCRIS_00717 (potA)
SSDB
Motif
Pfam: ABC_tran TOBE_2 SMC_N AAA_21 AAA AAA_29 AAA_22 AAA_15 RsgA_GTPase AAA_23 ABC_ATPase AAA_14 AAA_5 AAA_30 AAA_16
Other DBs
NCBI-ProteinID: CBL50164
UniProt: D5H2C9
LinkDB
Position
721772..722869
AA seq 365 aa
MDIIKLKHITKKYDDGFVALKDINLTIESGKFYSLLGPSGSGKSTILRIIAGFTQPSSGQ
VLFDGNDITDLDASKRHINTVFQNYALFPHLDVFQNVAFGLKIKKRPMSEIKPAVKDALH
MVRLDGYANREISELSGGQQQRVAIARAIVNEPKVLLLDESLSALDKRLRKDMQFELRAI
QKKLGITFIFVTHDQEEALSMSDEIFVLNDGQIQQSGNPVAIYDEPVNDFVARFIGDSNI
LSGRMIHDYEVEFANNKFKCADGGMKPNEKVEVVIRPEDLDIVKPEDGKIVVTAQTQLFL
GDHFEIKAIDANENEWLIHSTNGVKLGQRVGLFFDPEDIHVMRLNESQHDFDARLEKYEA
DENEK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggatattatcaaactaaaacacatcaccaaaaaatatgatgatgggtttgtagcatta
aaagatataaatttaactattgaatctggtaaattttattcactacttggtcctagtggc
tcgggaaaatcgacaattttgcgaattattgctggctttactcagccatctagtggtcaa
gtcctctttgatggtaatgatattactgaccttgatgcttcaaaaagacatatcaataca
gtttttcaaaattatgctttgtttccacacctggatgtttttcaaaatgtggcgtttggc
ttgaaaattaagaaaagaccaatgagtgaaatcaagccagctgttaaagatgctttgcat
atggttcgtctagacggttacgctaaccgcgaaatttcggaacttagtggaggacagcag
cagcgtgtagctattgcccgggcaattgttaatgaacctaaggttttactattagatgag
tcgctatctgctttggataaacgtttacgaaaagacatgcaatttgaattacgggcaatt
cagaaaaagctaggcattacctttatttttgttacgcacgatcaagaagaagctctatca
atgagtgatgaaatttttgttttaaatgatgggcagattcaacaaagtggtaatccggta
gcaatttacgatgagccagtgaatgactttgtagcacgttttattggtgactccaatatt
ttatctggtcgaatgattcatgattacgaagtggaatttgctaataataaatttaaatgt
gccgatggtgggatgaagcctaatgaaaaggttgaagtagttattcgtcccgaagacttg
gatattgttaaaccagaagatgggaagattgtggttacagcacagacgcaattattttta
ggtgatcactttgagattaaggcaattgatgccaatgaaaatgaatggctgatccattct
actaatggagttaaattgggacaacgtgttgggctcttttttgatccagaagatattcac
gtcatgcggttaaatgaaagtcaacacgattttgatgctcgactagaaaagtatgaggcg
gatgaaaatgaaaaataa

DBGET integrated database retrieval system