Lignipirellula cremea: Pla8534_20010
Help
Entry
Pla8534_20010 CDS
T06949
Symbol
nuoJ_1
Name
(GenBank) NADH-quinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
lcre
Lignipirellula cremea
Pathway
lcre00190
Oxidative phosphorylation
lcre01100
Metabolic pathways
Module
lcre_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
lcre00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
Pla8534_20010 (nuoJ_1)
Enzymes [BR:
lcre01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
Pla8534_20010 (nuoJ_1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
Motif
Other DBs
NCBI-ProteinID:
QDU94213
UniProt:
A0A518DQU8
LinkDB
All DBs
Position
2631013..2632197
Genome browser
AA seq
394 aa
AA seq
DB search
MNLLLFAPMILAQTDAAPIAAESAAPSPATMSLLVEALASPLLWSMVLGAVGLWLLLPGQ
AARSRGAAYFLALIQVATLLAVIWPAFEKAFSAFTPGLGILLGCSALSLVLLGAWLATDR
GGLGAFWFLAVLATAITASVLNTALWTPLLVLVLISAAMLVLLSPLATKSPRCGGAMLSI
GAVVLLGCMVAPTTEVDQAGWLFFWLLAGLTVFSAVAAVSMQSPVYSAIWFGVSLLATAG
LFLIQGAQFLSVATVAVYAGAILVTFLFVLMLAQPEGHSYYDRTSWGAFPTIAAVMAAAL
IVGGLTYRYTKLDSGPIGPSPRPAAATFEDGIGHPEHMAKLGGYMFSRHMLSVEAAGSLL
LAALVGAVAILIKGREEQEAAASRRSDRAEGGAA
NT seq
1185 nt
NT seq
+upstream
nt +downstream
nt
atgaacctgctgttgttcgcccccatgatcctggcgcaaacggacgccgctcccatcgcg
gctgagtcggcggccccgtcgccggcgacgatgagcctgctggtggaagcgctggcgtcg
cccttgctctggtcgatggtgctgggagcggtcggcctgtggctgctgctgccgggccag
gccgcccggagccgtggggctgcttactttttggcgctgatccaggtcgccaccctgctg
gcggtgatctggcctgcttttgaaaaggctttttccgctttcactcccggactgggaatt
ctgctgggctgctcggccttgtcgctggtattgctgggcgcctggctggcgaccgaccgc
ggcggactgggggccttttggtttctggccgtgctggcgacggcgattaccgcttcggtg
ctgaatacggcgttgtggactccgttgctggtgctggtgctgatctcggctgcgatgctg
gtgctgttgtccccgctggcgacgaagtcgccgcggtgcggcggggcgatgctgtccatc
ggggcggttgtgctgctgggctgcatggtggcacccacgaccgaagtcgatcaggccggc
tggctctttttctggctactggcgggactgacggtgttttccgcggtcgccgcagtcagc
atgcagagccctgtctatagtgcgatctggtttggcgtgtcgctgctggcgacggccggt
ctgttcctgatccagggcgctcagtttttgagcgtggcgaccgtggcggtttacgccggc
gccattctggtgacgttcctgtttgtgctgatgctggcccagccagagggccattcctat
tacgaccggaccagctggggcgcctttccgacgatcgctgcggtgatggcggcggcgttg
atcgtcggcggtttaacgtatcggtataccaaactggattcggggccgatcggtccttcc
ccccggccggcggccgccacgtttgaggacggcatcggccatcctgaacacatggcgaag
ctgggcggctatatgttcagccgacacatgctctcggtggaagcggccggttccctgctg
ctggcggcgctcgtcggggcagtggccattttgatcaaaggccgcgaagaacaagaggcc
gccgcatcgcggcgttccgatcgtgcggaaggaggggccgcatga
DBGET
integrated database retrieval system