Lignipirellula cremea: Pla8534_28560 Help Entry Pla8534_28560     CDS       T06949                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism lcre  Lignipirellula cremea Pathway lcre01100   Metabolic pathways lcre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lcre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pla8534_28560 (acpP_1)    00074 Mycolic acid biosynthesis     Pla8534_28560 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pla8534_28560 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TagH_SH3-like Motif Other DBs NCBI-ProteinID:  QDU95045 UniProt:  A0A518DT69 LinkDB All DBs Position complement(3783669..3783935) Genome browser AA seq 88 aa AA seqDB search MKPADIREEIIDILGDIAPDEDLGDLTDEKPFREQLELDSMDFLDIVMELRKRYRIQIPE EDYPHLASMQSTVDYLTPIMKDMERQGA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaagcccgccgacatccgcgaggaaatcattgatattctcggcgacattgcccccgat gaagacctgggcgatctcaccgatgaaaagccgttccgcgagcagctggaactcgacagc atggacttcctcgacatcgtcatggaattgcggaagcgctaccgcattcagattcccgaa gaggattatccgcacctggccagcatgcaaagcacggtcgactatctcacgcccatcatg aaagacatggaacgccagggcgcttaa

DBGET integrated database retrieval system