KEGG   Lignipirellula cremea: Pla8534_61910
Entry
Pla8534_61910     CDS       T06949                                 
Symbol
dinG
Name
(GenBank) putative ATP-dependent helicase DinG
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
lcre  Lignipirellula cremea
Brite
KEGG Orthology (KO) [BR:lcre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcre03400]
    Pla8534_61910 (dinG)
Enzymes [BR:lcre01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     Pla8534_61910 (dinG)
DNA repair and recombination proteins [BR:lcre03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    Pla8534_61910 (dinG)
SSDB
Motif
Pfam: Helicase_C_2 DEAD DEAD_2 ResIII DUF4411
Other DBs
NCBI-ProteinID: QDU98324
UniProt: A0A518E2M5
LinkDB
Position
complement(8280202..8282187)
AA seq 661 aa
MLTPTDILGPGGRISARLPHYEHRTEQLAMADAVASALKGSHHLVAEAGTGVGKSFAYLV
PAILRVAAAQAASDGTKEPLRIVVSTHTIALQEQLLQKDLPLLRSVIPYEFTAVLAKGRR
NYLSLRRLQNAHTRARSLFFSEQEFEQLQQVQRWSEQSADGSRSDLSFEPQSSVWDEVAS
DSGNCMGRKCPTHKECFYFRARRRLQHAQILVVNHALFFTDLALRRAGVNLLPDYQAVIL
DEAHTIESVASDHLGLGVASGQVDYLLNRLYNDHTNKGLLVEPALRQAQEQVLRCRHRAD
DFFGELYAWLNQGKSSTARVRTPEIVPNELSGALQKLSELIKDHAESLEDTKKQDYTSAA
ERLTVLASEIESWRQQQSPESVYWVEGSVNRQNKTRIKLSAAPLDVGPSLREALFDQIPS
VVLTSATLGVGDGGSFSFFKSRVGLTQTEEIRLGSPFNYQEQAKVVLVEGMADPGRETAE
FDRQVHAMIRRYVGQTDGRAFVLFTSYGAMRKAVAELTPWLIERNLALYAQSDGLPRSQM
VERFQQNPRAVLMGVSSFWQGVDVPGDALQNVIITKLPFSVPDHPLLEARLETIRAAGGN
PFVDYQLPEAVIKLRQGFGRLIRTRRDRGMVVLLDPRLRSKPYGKIFLDSLPPCPRVIDA
L
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgcttacccctacggatattctaggtcccggcggccgtatttccgcccgactgccgcat
tacgagcatcggacggaacaactggcgatggccgatgcggtcgccagcgccctgaagggg
tcgcatcatctggtcgcggaggccggcactggcgttggcaaaagctttgcctacctggtt
cccgccattctccgggtggcggccgcccaggccgcttcggatggaacgaaggagccgctg
cggatcgtcgtttcgacgcatacgatcgcgttgcaggagcagttgctgcagaaagacttg
cccctgctgcggagcgtcatcccgtacgaattcacggccgtcctcgccaagggacgtcgc
aattatttgagtctgcgccgactgcagaacgcgcatacgcgggcccgcagcttgttcttt
tcagaacaggaatttgaacagctgcagcaggtgcagcgctggtcggaacagtcggccgac
ggctctcgcagcgatctttcttttgaaccgcaatccagcgtctgggacgaagtcgccagc
gacagcggcaattgcatgggacggaagtgccccacgcacaaagagtgcttttacttccgc
gcccggcgccgcctgcagcatgcgcaaattctggtcgtgaaccatgccctgttcttcacc
gatctggccctgcgaagggccggcgtgaacctgctgcccgactaccaggcggtcattctc
gatgaagcccacacgatcgaatcggtcgccagcgatcatctgggcctgggcgttgcttcg
ggccaggtcgattacctgctgaatcggctttacaacgaccacaccaacaaaggattgctg
gtggagccggccttgcgccaggcgcaggaacaggtgctccgctgccggcatcgagccgat
gatttctttggcgagctctatgcgtggctgaatcagggaaaaagctccaccgcccgggtc
cgcacgccggagatcgtgccgaacgagctcagcggggccctgcagaagctgtcggagctg
atcaaggaccatgcggaatcgctggaagatacgaagaagcaggactacacctcggccgcg
gaacggctcaccgtgctggcttccgagattgaaagctggcgacagcagcaatcgccggag
tcggtctactgggtcgaaggcagcgtgaatcgccagaacaagacacgcatcaaactctct
gccgcgccgctcgatgtgggccccagcctgcgcgaggccctgtttgaccagatcccttcc
gtcgtgctgaccagcgcgacgctgggcgtcggcgacggcggctcgttcagctttttcaaa
tcgcgcgtcggcctgacccagacggaagaaatccgactgggcagtccgttcaactaccag
gaacaagccaaggtggtgctggtcgaagggatggccgatccggggcgagaaacggccgag
tttgatcggcaggtgcacgccatgattcgccggtatgtgggtcagaccgatggccgggcc
tttgtgctgttcaccagttacggagcgatgcgcaaggcggtggccgagttgacgccctgg
ctgattgagcggaatctggccctgtacgcccagtcggacggactgccccgcagccagatg
gtcgagcgattccagcagaacccgcgggccgtcctgatgggagtctccagtttctggcaa
ggcgtcgatgtgccgggcgacgcgctgcagaatgtgattatcaccaaactgcccttcagt
gtgcccgatcatcccctgctggaagctcggctggaaacgatccgcgccgccggcggcaat
ccgtttgtcgactaccagctgcccgaggcggtcattaaacttcgccagggtttcgggcgt
ttgatccgtacgcgtcgcgatcgcggaatggtggtgctgctggacccgcgcttgcgcagc
aaaccgtatgggaagatatttctcgattctttgcccccttgcccgcgcgtgattgacgcc
ctttga

DBGET integrated database retrieval system