Lacticaseibacillus casei 12A: LCA12A_1269 Help Entry LCA12A_1269       CDS       T03665                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lcx  Lacticaseibacillus casei 12A Pathway lcx01100   Metabolic pathways lcx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lcx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LCA12A_1269    00074 Mycolic acid biosynthesis     LCA12A_1269   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LCA12A_1269 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 TerB Cadherin WHD_SNRNP200 Motif Other DBs NCBI-ProteinID:  EKP99594 LinkDB All DBs Position complement(1621827..1622069) Genome browser AA seq 80 aa AA seqDB search MSEDEIYQKIAGLIQDHFQLSPDKISPTLNFQKDLDADSIDIVEFVLELEDAFGAEIPDD DAENIKTVQDAVDYINAHQK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagtgaagacgaaatttatcaaaaaattgccggcctaattcaggaccattttcaacta agtcccgataaaatcagcccgacacttaactttcaaaaggatcttgatgcggattcaatt gacatcgttgaatttgttttagagttagaagatgccttcggagcagaaatccccgatgac gacgccgaaaacatcaaaacagttcaagatgccgttgattacatcaacgcccatcagaag tga

DBGET integrated database retrieval system