Leptosomus discolor (cuckoo roller): 104340429 Help Entry 104340429         CDS       T08399                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi03010   Ribosome ldi04120   Ubiquitin mediated proteolysis ldi04137   Mitophagy - animal ldi04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:ldi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     104340429   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104340429  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104340429    04137 Mitophagy - animal     104340429  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ldi03011]     104340429    04121 Ubiquitin system [BR:ldi04121]     104340429 Ribosome [BR:ldi03011]  Ribosomal proteins   Eukaryotes    Large subunit     104340429   Archaea     104340429 Ubiquitin system [BR:ldi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    104340429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Ribosomal_L40e DUF2604 Rad60-SLD_2 UBL_UBAC1 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N Motif Other DBs NCBI-GeneID:  104340429 NCBI-ProteinID:  XP_009952943 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MQIFVKTLTGKTITLEVEPNDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcgtgaagacgctgacgggcaaaaccatcacccttgaggtggagcccaac gatacgatcgagaacgtgaaggccaagatccaggacaaggaagggatcccccctgaccag cagcggctgatcttcgcgggcaagcagctggaggatggccgcaccctcgcagactacaac atccagaaagagtccaccctccacctggtgctgcgcctgcgggggggcatcatcgagccc tccctccgccagctcgcccagaagtacaactgcgacaaa

DBGET integrated database retrieval system