Leptosomus discolor (cuckoo roller): 104341741 Help Entry 104341741         CDS       T08399                                  Name (RefSeq) histone H2B, gonadal-like   KO K11252   histone H2B Organism ldi  Leptosomus discolor (cuckoo roller) Brite KEGG Orthology (KO) [BR:ldi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ldi03036]     104341741   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104341741 Chromosome and associated proteins [BR:ldi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104341741 Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104341741 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa DUF1931 ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  104341741 NCBI-ProteinID:  XP_009954812 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MGVEAGKKHDHAPSSGDRRSKRKPKRKETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVN DIFERLASEASRLAQYNHRSTITSREVQTAVRLLLPGEL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgggtgtggaagctgggaagaagcatgaccatgctcccagctctggggacaggaggtct aagagaaagccaaagagaaaggaaacctattcggtctatatctacaaagtactgaagcag gtgcatccagacactggcatctcctctaaggccatgagcatcatgaactccttcgtcaat gatatcttcgagcgtctggcctcagaggcctcgcgcctggcccagtacaaccaccgctcc accatcaccagccgtgaggtgcagacggccgtgaggctcctgctgcccggcgagctg

DBGET integrated database retrieval system