Leptosomus discolor (cuckoo roller): 104343512 Help Entry 104343512         CDS       T08399                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04020   Calcium signaling pathway ldi04070   Phosphatidylinositol signaling system ldi04114   Oocyte meiosis ldi04218   Cellular senescence ldi04261   Adrenergic signaling in cardiomyocytes ldi04270   Vascular smooth muscle contraction ldi04371   Apelin signaling pathway ldi04625   C-type lectin receptor signaling pathway ldi04744   Phototransduction ldi04910   Insulin signaling pathway ldi04912   GnRH signaling pathway ldi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104343512    04020 Calcium signaling pathway     104343512    04070 Phosphatidylinositol signaling system     104343512  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104343512    04218 Cellular senescence     104343512  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104343512   09152 Endocrine system    04910 Insulin signaling pathway     104343512    04912 GnRH signaling pathway     104343512    04916 Melanogenesis     104343512   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104343512    04270 Vascular smooth muscle contraction     104343512   09157 Sensory system    04744 Phototransduction     104343512  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ldi01009]     104343512   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ldi04131]     104343512    03036 Chromosome and associated proteins [BR:ldi03036]     104343512   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104343512 Protein phosphatases and associated proteins [BR:ldi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104343512 Membrane trafficking [BR:ldi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104343512 Chromosome and associated proteins [BR:ldi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104343512 Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104343512 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg EFhand_Ca_insen EF-hand_11 Dockerin_1 Caleosin UPF0154 FCaBP_EF-hand DUF5580_M SPEF2_C Motif Other DBs NCBI-GeneID:  104343512 NCBI-ProteinID:  XP_009945724 UniProt:  A0A091PJP8 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAERLSEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTVDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EGDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcggctgtcggaggagcaaatcgccgaattcaaggaggctttttcccttttt gaccgggatggagacggttgcatcaccacgaaggagttgggcaccgtcatgcgctcgttg gggcaaaaccccaccgaagcggagctgcaggacatggtgggggaggtggacgccgacggc agcggcaccgtcgacttccccgagttcctctcgctgatggcgaggaagatgagggacacg gacagcgaggaggagatccgcgaggccttccgcgtcttcgacaaggacggcaacggctac atcagcgcggcggagctgcggcacgtcatgaccaacctgggtgagaagctgacggacgag gagggggacgagatgatcaaagaggccgactgcaacaatgacgggcaggtcaactacgag gagtttgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system