Leptosomus discolor (cuckoo roller): 104344997 Help Entry 104344997         CDS       T08399                                  Name (RefSeq) fibroblast growth factor 10-like   KO K04358   fibroblast growth factor Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04010   MAPK signaling pathway ldi04020   Calcium signaling pathway ldi04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104344997    04020 Calcium signaling pathway     104344997  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104344997  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ldi04052]     104344997    00536 Glycosaminoglycan binding proteins [BR:ldi00536]     104344997 Cytokines and neuropeptides [BR:ldi04052]  Cytokines   Growth factors (RTK binding)    104344997 Glycosaminoglycan binding proteins [BR:ldi00536]  Heparan sulfate / Heparin   Growth factors/receptors    104344997 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF SR-25 DUF1459 TRAPPC9-Trs120 Motif Other DBs NCBI-GeneID:  104344997 NCBI-ProteinID:  XP_009947602 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MCKWILTNGASAFSHLPCCCLLLLFLVSSVPVTCHDLGQDMLSPEATNSSSSSSSSFPSS FSSPSSAGRHVRSYNHLQGDVRKRKLYSYNKYFLKIEKNGKVSGTKKENCPF NT seq 337 nt NT seq  +upstreamnt  +downstreamnt atgtgcaaatggatactgacaaatggtgcctcagccttttcccacctgccttgttgctgc ttgctgctgctcttcttggtgtcttctgtgcctgtcacctgccatgacctcggccaggac atgctgtccccggaggccaccaactcttcttcttcatcatcctcctccttcccctcgtcc ttctcctctccttccagtgcggggagacacgtgcggagctacaatcacctccaaggagac gtgcgcaagaggaagctctactcttacaacaagtactttctcaagattgagaagaacggc aaggtcagcggcaccaagaaggagaactgccccttca

DBGET integrated database retrieval system