Leptosomus discolor (cuckoo roller): 104345982 Help Entry 104345982         CDS       T08399                                  Symbol NXT2 Name (RefSeq) NTF2-related export protein 2   KO K14285   NTF2-related export protein 1/2 Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi03008   Ribosome biogenesis in eukaryotes ldi03013   Nucleocytoplasmic transport ldi03015   mRNA surveillance pathway ldi05164   Influenza A Brite KEGG Orthology (KO) [BR:ldi00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     104345982 (NXT2)    03015 mRNA surveillance pathway     104345982 (NXT2)    03008 Ribosome biogenesis in eukaryotes     104345982 (NXT2)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104345982 (NXT2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ldi03019]     104345982 (NXT2)    03009 Ribosome biogenesis [BR:ldi03009]     104345982 (NXT2) Messenger RNA biogenesis [BR:ldi03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      104345982 (NXT2) Ribosome biogenesis [BR:ldi03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     104345982 (NXT2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 SnoaL_2 Motif Other DBs NCBI-GeneID:  104345982 NCBI-ProteinID:  XP_009948897 UniProt:  A0A091PU25 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MISSLQDFKTYVDQACRAADEFVNIYYETMDKRRRALSRLYLDKATLVWNGNAVSGQEEL NKFFEMLPSSEFQVNVLDCQPVHEQATQGQTTVLVVTSGTVKFDGDKQRYFNQNFLLTAQ ATPTNTVWKIASDCFRFQDWAS NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgatttcttctctccaggatttcaaaacctacgtggatcaagcttgtagagccgcagat gaatttgtcaacatttattatgagacaatggataaaagaagaagggctttatcaagactt tacttggacaaagcaacgttagtttggaatggtaacgcagtgtccgggcaagaagaattg aacaaattttttgaaatgttgccatctagtgaattccaggttaatgtgttggactgccag cccgttcacgagcaagctactcaaggccagacgacagtcctcgtggtgacaagtgggaca gtaaaatttgatggcgacaagcagcgctacttcaatcagaacttcttgctaacggcacaa gccacacctaccaacacggtgtggaagatcgccagtgactgtttccgctttcaggactgg gccagttag

DBGET integrated database retrieval system