Leptosomus discolor (cuckoo roller): 104347792 Help Entry 104347792         CDS       T08399                                  Symbol FGF17 Name (RefSeq) fibroblast growth factor 17   KO K04358   fibroblast growth factor Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04010   MAPK signaling pathway ldi04020   Calcium signaling pathway ldi04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104347792 (FGF17)    04020 Calcium signaling pathway     104347792 (FGF17)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104347792 (FGF17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ldi04052]     104347792 (FGF17)    00536 Glycosaminoglycan binding proteins [BR:ldi00536]     104347792 (FGF17) Cytokines and neuropeptides [BR:ldi04052]  Cytokines   Growth factors (RTK binding)    104347792 (FGF17) Glycosaminoglycan binding proteins [BR:ldi00536]  Heparan sulfate / Heparin   Growth factors/receptors    104347792 (FGF17) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF S4 Motif Other DBs NCBI-GeneID:  104347792 NCBI-ProteinID:  XP_009951229 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search GENQPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVNGKRITATAEDGNKFA KLIVETDTFGSRVRIKGAESEKYICMSKRGKLIGKPNGKSKDCIFTEIVLENNYTAFQNA RYEGWYMAFT NT seq 390 nt NT seq  +upstreamnt  +downstreamnt ggggagaatcaaccgtctcctaattttaaccagtacgtgagggaccagggtgccatgacc gaccagctgagccgacggcagatcagggagtaccagctctacagccggaccagcggcaag cacgtccaggtgaacggcaaaaggatcaccgccaccgccgaggacggcaacaagttcgcc aagctcatcgtggagacggacaccttcgggagccgcgtccgcatcaagggggccgagagc gagaagtacatctgcatgagcaagcggggcaagctcatcgggaaacccaacggcaagagc aaggactgcatcttcacggagatcgtgctggagaacaactacacggcgttccaaaacgcc cgctacgagggctggtacatggccttcacc

DBGET integrated database retrieval system