Leptosomus discolor (cuckoo roller): 104348931 Help Entry 104348931         CDS       T08399                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism ldi  Leptosomus discolor (cuckoo roller) Brite KEGG Orthology (KO) [BR:ldi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ldi03036]     104348931   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104348931 Chromosome and associated proteins [BR:ldi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104348931 Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104348931 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104348931 NCBI-ProteinID:  XP_009952626 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAS EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt aagcctcaccgctacaggccgggcaccgtcgccctccgtgagatccgccgctaccagaag tccacggagctgctgatcaggaagctgcccttccagcggctggtcagggaaatcgcccag gatttcaaaacagacttgaggttccagagtgcagccatcggtgcgctgcaggaggccagc gaagcatatctggtgggtctgtttgaagatacaaacctgtgcgccatccatgctaagaga gtcaccatcatgcccaaagatatccagttggctcgcaggatacggggggagagggcttaa

DBGET integrated database retrieval system