Leptosomus discolor (cuckoo roller): 104349093 Help Entry 104349093         CDS       T08399                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04010   MAPK signaling pathway ldi04020   Calcium signaling pathway ldi04114   Oocyte meiosis ldi04218   Cellular senescence ldi04310   Wnt signaling pathway ldi04370   VEGF signaling pathway ldi04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104349093 (PPP3R1)    04310 Wnt signaling pathway     104349093 (PPP3R1)    04370 VEGF signaling pathway     104349093 (PPP3R1)    04020 Calcium signaling pathway     104349093 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104349093 (PPP3R1)    04218 Cellular senescence     104349093 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104349093 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ldi01009]     104349093 (PPP3R1) Protein phosphatases and associated proteins [BR:ldi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104349093 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  104349093 NCBI-ProteinID:  XP_009952829 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcgcactttgatgctgatgagataaaacgactaggaaagagatttaagaagctt gatttggacaactctggttctttgagcgtggaagagttcatgtctttacctgaattgcaa cagaacccattagtacagcgagtaatagatatatttgacacagatggaaatggagaagtg gacttcaaagaatttatagaaggagtctcccagttcagtgtcaaaggagataaggaacag aagttgaggtttgcctttcgcatttacgatatggacaaagatggttatatctcaaatgga gagctcttccaggtgctgaagatgatggttgggaacaatctcaaagacactcagttacag caaattgtagataaaaccataattaatgcagataaggatggtgatggaagaatatccttt gaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatggtcgtagatgtg tga

DBGET integrated database retrieval system