Leptosomus discolor (cuckoo roller): 104349454 Help Entry 104349454         CDS       T08399                                  Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04140   Autophagy - animal ldi04144   Endocytosis ldi04530   Tight junction Brite KEGG Orthology (KO) [BR:ldi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104349454    04140 Autophagy - animal     104349454   09144 Cellular community - eukaryotes    04530 Tight junction     104349454  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ldi04131]     104349454    03036 Chromosome and associated proteins [BR:ldi03036]     104349454   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104349454    04031 GTP-binding proteins [BR:ldi04031]     104349454 Membrane trafficking [BR:ldi04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     104349454  Autophagy   Other autophagy associated proteins     104349454 Chromosome and associated proteins [BR:ldi03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     104349454 Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104349454   Exosomal proteins of other body fluids (saliva and urine)    104349454   Exosomal proteins of colorectal cancer cells    104349454 GTP-binding proteins [BR:ldi04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     104349454 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc DUF3963 Motif Other DBs NCBI-GeneID:  104349454 NCBI-ProteinID:  XP_009953303 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MGIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILGNKCDANDKRQVSREQGEKLAA SFGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKKSSF FRCVLL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgggcattatgttagtctacgacatcaccaatgaaaaatcttttgaaaatattcggaac tgggtcaggaatattgaagagcacgcctctcctgacgttgagaaaatgatccttgggaac aaatgtgatgcaaatgacaagagacaagtttctagagagcaaggggagaagcttgctgcg agttttggcattaaatttatggagaccagtgcaaaagcaaatataaacatcgagaacgca tttttcactcttgcaagagatatcaaagcaaaaatggacaagaagttggaaggcaacagc ccgcaaggcagtaaccagggagtcaaaatcacaccagaccagcaaaagaaaagcagcttt ttccgatgtgttcttctgtga

DBGET integrated database retrieval system