Leptosomus discolor (cuckoo roller): 104350318 Help Entry 104350318         CDS       T08399                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism ldi  Leptosomus discolor (cuckoo roller) Brite KEGG Orthology (KO) [BR:ldi00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ldi03037]     104350318 (TMEM218) Cilium and associated proteins [BR:ldi03037]  Primary cilia and associated proteins   MKS complex    104350318 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gemini_mov Motif Other DBs NCBI-GeneID:  104350318 NCBI-ProteinID:  XP_009954414 LinkDB All DBs Position Unknown AA seq 44 aa AA seqDB search IVDTFFIGRFVLLAVMSLVVLGCLFLLLIYHLMEPVYAKPLRSS NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atcgtggacaccttctttatcggccgtttcgtcctcctggccgtgatgagcctggttgta ctggggtgcctcttcctgctcctgatttatcacctcatggagccggtgtacgccaaaccg ctccgcagcagctag

DBGET integrated database retrieval system